• USA Home
  • MSST0034 - SILuLite COL1A1 N-terminal propeptide human

EMAIL THIS PAGE TO A FRIEND
MSST0034 Sigma-Aldrich

SILuLite COL1A1 N-terminal propeptide human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonym: Collagen alpha-1(I) chain, Collagenalpha-1(I)chain, P1NP

Purchase

Properties

Related Categories Biochemicals and Reagents, Proteins and Derivatives, SILuLite Protein Standards for Quantitative Mass Spectrometry More...
Quality Level   200
biological source   human
recombinant   expressed in HEK 293 cells
assay   ≥98% (SDS-PAGE)
form   lyophilized powder
potency   ≥98% Heavy amino acids incorporation efficiency by MS
application(s)   mass spectroscopy (MS): suitable
suitability   suitable for mass spectrometry (internal calibrator)
UniProt accession no.   P02452
storage temp.   −20°C
Gene Information   human ... COL1A1(1277)

Description

General description

Collagen type I is present in soft connective tissues and bone, where it constitutes more than 90% of the organic matrix.1 During bone formation collagen type I is synthesized from pro-collagen type I, which is secreted from fibroblasts and osteoblasts.2 Pro-collagen type I contains N-and C-terminal extensions, which are removed by specific proteases during the conversion of procollagen to collagen.3 Measurements of N- terminal propeptides of procollagen type I (PINP) can be of value in assessing bone formation. Recent evidence indicates that PINP can serve as a serum biomarker of bone formation, as it accurately identifies those patients who are responding to anabolic or antiresorptive therapy within 3 months of the start of treatment.4 The use of this biomarker in patients being treated for osteoporosis may significantly improve therapy adherence and clinical outcomes.4

Immunogen

QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPDYKDDDDKGHHHHHHHHGGQ

Biochem/physiol Actions

SILuLite COL1A1 recombinant human protein expressed in human 293 cells. It is a protein of 159 amino acids (Q23-P161 and including C-terminal polyhistidine and FLAG® tags) with a calculated molecular mass of 16 kDa. SILu Lite COL1A1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Physical form

Lyophilized from a solution of phosphate buffered saline.

Legal Information

FLAG is a registered trademark of Sigma-Aldrich Co. LLC

SILu is a trademark of Sigma-Aldrich Co. LLC

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 2
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Related Content

Stable Isotope-labeled MS Internal Standards

What happens when you combine state-of-the-art technology with scientific prowess? Full-length protein standards with the highest purity and isotopic incorporation in the industry. Stable isotope-lab...
Keywords: Atomic absorption spectroscopy, Buffers, Digestions, Mass spectrometry, PAGE, Phosphorylations

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?