• USA Home
  • MSST0057 - SILuProt IL8, Interleukin-8 human

EMAIL THIS PAGE TO A FRIEND
MSST0057 Sigma-Aldrich

SILuProt IL8, Interleukin-8 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

Synonym: C-X-C motif chemokine 8 chemokine (C-X-C motif), Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), IL-8, Monocyte-derived neutrophil-activating peptide (MONAP), Monocyte-derived neutrophil, Neutrophil-activating protein 1 (NAP-1), Protein 3-10C, T-cell chemotactic factor, chemotactic factor (MDNCF), ligand 8

  •  NACRES NA.32

Purchase

Properties

Related Categories Biochemicals and Reagents, Proteins and Derivatives, SILuProt Protein Standards for Quantitative Mass Spectrometry More...
Quality Level   200
recombinant   expressed in HEK 293 cells
assay   ≥95% (SDS-PAGE)
form   lyophilized powder
potency   ≥98% (Heavy amino acids incorporation efficiency by MS)
suitability   suitable for mass spectrometry (standard)
UniProt accession no.   P10145
shipped in   ambient
storage temp.   −20°C
Gene Information   human ... CXCL8(3576)

Description

General description

SILuProt IL8 is a recombinant, stable isotope-labeled human CXCL8 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of CXCL8 in mass-spectrometry. SILuProt IL8 is a mixture of the 3 main CXCL8 isoforms with the molecular weights, amino acid number and relative abundance as described in Table 1 of the product′s datasheet.

Biochem/physiol Actions

Interleukin-8 (IL-8) is a member of the CXC chemokine subfamily and is produced by blood cells and many types of tissues. The measurement of IL-8 in voided urinary samples may have utility for urine-based detection of bladder cancer. Urinary IL-8 was a strong biomarker of stress under intensive and prolonged demands, both acutely and over time. IL-8 and cathepsin B levels were significantly elevated in melanoma patients, and more importantly, the combination of IL-8 and cathepsin B were also studied as a prognosis marker for melanoma mortality.

Sequence

EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles
Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?