• USA Home
  • MSST0063 - SILuProt IGF-1, Insulin Growth Factor -1 human

EMAIL THIS PAGE TO A FRIEND
MSST0063 Sigma-Aldrich

SILuProt IGF-1, Insulin Growth Factor -1 human

recombinant, expressed in E. coli, SIL MS Protein Standard, 15N-labeled

Synonym: IGF-A, Human, Insulin Growth Factor-I, Human, Insulin-Like Growth Factor-I, Human, Insulin-like growth factor I, Myotrophin, SM-C, Somatomedin 1, Sulfation Factor C, rhIGF-I

  •  NACRES NA.12

Purchase

Properties

Related Categories Biochemicals and Reagents, Proteins and Derivatives, SILuProt Protein Standards for Quantitative Mass Spectrometry More...
Quality Level   200
recombinant   expressed in E. coli
assay   ≥95% (SDS-PAGE)
form   lyophilized
potency   ≥97% (Heavy amino acids incorporation efficiency by MS)
suitability   suitable for mass spectrometry (standard)
UniProt accession no.   P05019 (Gly49-Ala118)
shipped in   ambient
storage temp.   −20°C

Description

General description

SILuProt IGF-1 is a recombinant, stable 15N isotope-labeled human IGF-1. Expressed in E. coli, it is designed to be used as an internal standard for bioanalysis of IGF-1 in mass-spectrometry. SILuProt IGF-1 is a protein of 70 amino acids, with a calculated molecular mass of 7.74 kDa.

Biochem/physiol Actions

Insulin-like growth factor 1 (IGF-1), also called somatomedin C, is a protein that in humans is encoded by the IGF1 gene. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have anabolic effects in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure.

Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Physical form

Supplied as a lyophilized powder containing tris buffered saline and methionine

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 2
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles
Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?