• USA Home
  • SAB1402157 - Monoclonal Anti-CRY2 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1402157 Sigma-Aldrich

Monoclonal Anti-CRY2 antibody produced in mouse

clone 3H4, purified immunoglobulin, buffered aqueous solution

Synonym: FLJ10332, HCRY2, KIAA0658, PHLL2

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CR-CR, Primary Antibodies
conjugate   unconjugated
clone   3H4, monoclonal
biological source   mouse
application(s)   capture ELISA: suitable
  immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
species reactivity   human
mol wt   antigen ~36.12 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2aκ
Quality Level   100
antibody product type   primary antibodies
NCBI accession no.   NM_021117
UniProt accession no.   Q49AN0
Gene Information   human ... CRY2(1408)

Description

General description

Cryptochrome circadian regulator 2 (CRY2) is a core circadian gene and transcriptional repressor. CRY2 gene is located on the human chromosome 11p11.2.

Immunogen

CRY2 (NP_066940.1, 141 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQG

Physical form

Solution in phosphate buffered saline, pH 7.4

Biochem/physiol Actions

Cryptochrome circadian regulator 2 (CRY2) is involved in DNA damage checkpoint control and cell cycle progression. It maintains the circadian rhythm through a circadian feedback loop. It is also important in immune system coordination and hematologic system development. CRY2 is a potential circadian biomarker for non-Hodgkin′s lymphoma (NHL). CRY2 is linked to rapid cycling in bipolar disorder. CRY2 functions as light-sensitive magnetosensor.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?