• USA Home
  • SAB1402161 - Monoclonal Anti-CSNK1E antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1402161 Sigma-Aldrich

Monoclonal Anti-CSNK1E antibody produced in mouse

clone 2E1, purified immunoglobulin, buffered aqueous solution

Synonym: HCKIE, MGC10398

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CS-CS, Primary Antibodies
conjugate   unconjugated
clone   2E1, monoclonal
biological source   mouse
application(s)   immunofluorescence: suitable
  indirect ELISA: suitable
  proximity ligation assay: suitable
species reactivity   human
mol wt   antigen ~37 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2aκ
antibody product type   primary antibodies
NCBI accession no.   NM_152221
UniProt accession no.   P49674
Gene Information   human ... CSNK1E(1454)

Description

General description

The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Immunogen

CSNK1E (NP_689407, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKF

Physical form

Solution in phosphate buffered saline, pH 7.4

Biochem/physiol Actions

Casein kinase 1 ε (CSNK1E) phosphorylates proteins of the Wnt signaling cascade. It modulates tumor growth and cell division in salivary gland cancer, pancreatic and colon adenocarcinoma cells. CSNK1E phosphorylates dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32) and modulates dopamine receptor signaling. It also interacts with proteins involved in circadian rhythm.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?