• USA Home
  • SAB1402487 - Monoclonal Anti-RNF40 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1402487 Sigma-Aldrich

Monoclonal Anti-RNF40 antibody produced in mouse

clone 1C1, purified immunoglobulin, buffered aqueous solution

Synonym: BRE1B, DKFZp686K191, KIAA0661, MGC13051, RBP95, STARING

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, RH-RN
species reactivity   human
application(s)   capture ELISA: suitable
  immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
clone   1C1, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG2aκ
mol wt   antigen mol wt ~37 kDa
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... RNF40(9810)
biological source   mouse
antibody product type   primary antibodies
conjugate   unconjugated
NCBI accession no.   NM_014771
UniProt accession no.   O75150

Description

Immunogen

RNF40 (NP_055586, 102 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DETVEALLRCHESQGELSSAPEAPGTQEGPTCDGTPLPEPGTSELRDPLLMQLRPPLSEPALAFVVALGASSSEEVELELQGRMEFSKAAVSRVVEASD

General description

The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the rat counterpart suggested that this protein may function as an E3 ubiquitin-protein ligase, and facilitate the ubiquitination and degradation of syntaxin 1, which is an essential component of the neurotransmitter release machinery. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?