• USA Home
  • SAB1402600 - Monoclonal Anti-RIOK2, (C-terminal) antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1402600 Sigma-Aldrich

Monoclonal Anti-RIOK2, (C-terminal) antibody produced in mouse

clone 1B10, purified immunoglobulin, buffered aqueous solution

Synonym: FLJ11159

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, RH-RN
conjugate   unconjugated
clone   1B10, monoclonal
biological source   mouse
application(s)   immunofluorescence: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
species reactivity   human
mol wt   antigen ~37 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2bκ
Quality Level   100
antibody product type   primary antibodies
NCBI accession no.   BC000953
UniProt accession no.   Q9BVS4
Gene Information   human ... RIOK2(55781)

Description

Immunogen

RIOK2 (AAH00953.1, 453 a.a. ~ 551 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IALSSLNREFRPFRDEENVGAMNQYRTRTLSITSSGSAVSCSTIPPELVKQKVKRQLTKQQKSAVRRRLQKGEANIFTKQRRENMQNIKSSLEAASFWG

Physical form

Solution in phosphate buffered saline, pH 7.4

Biochem/physiol Actions

Serine/threonine-protein kinase RIO2 (RIOK2) is a non-ribosomal factor required for normal ribosomal RNA biogenesis and cell cycle progression. It is necessary for processing of 20S pre-rRNA to the 18S rRNA in 40S ribosomal subunit synthesis. RIOK2 is also a ribosomal assembly factor that prevents premature translation initiation on the small (40S) subunit. It is needed for proper mitotic progression, regulates metaphase-anaphase transition and is a substrate of Plk1 (polo-like kinase1) which is phosphorylated by Plk1 at the Ser-335, Ser-380, and Ser-548 residues.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?