• USA Home
  • SAB1403180 - Monoclonal Anti-WSB1 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1403180 Sigma-Aldrich

Monoclonal Anti-WSB1 antibody produced in mouse

clone 3E10, purified immunoglobulin, buffered aqueous solution

Synonym: SWIP1, WSB-1

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, W
conjugate   unconjugated
clone   3E10, monoclonal
biological source   mouse
application(s)   capture ELISA: suitable
  indirect ELISA: suitable
species reactivity   human
mol wt   antigen ~35.46 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2aκ
Quality Level   100
antibody product type   primary antibodies
NCBI accession no.   BC021110
UniProt accession no.   Q9Y6I7
Gene Information   human ... WSB1(26118)

Description

General description

This gene encodes a member of the WD-protein subfamily. This protein shares a high sequence identity to mouse and chick proteins. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)

Immunogen

WSB1 (AAH21110.1, 53 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFG

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?