• USA Home
  • SAB1403328 - Monoclonal Anti-RPTOR, (C-terminal) antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1403328 Sigma-Aldrich

Monoclonal Anti-RPTOR, (C-terminal) antibody produced in mouse

clone 3C2, purified immunoglobulin, buffered aqueous solution

Synonym: KOG1, Mip1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, RO-RP
species reactivity   human
application(s)   indirect ELISA: suitable
clone   3C2, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG2aκ
mol wt   antigen mol wt ~38.21 kDa
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... RPTOR(57521)
biological source   mouse
antibody product type   primary antibodies
conjugate   unconjugated
NCBI accession no.   NM_020761
UniProt accession no.   Q8N122

Description

Immunogen

RPTOR (NP_065812.1, 1226 a.a. ~ 1335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR

General description

This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?