• USA Home
  • SAB1403365 - Monoclonal Anti-BIRC7, (N-terminal) antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1403365 Sigma-Aldrich

Monoclonal Anti-BIRC7, (N-terminal) antibody produced in mouse

clone 3H1, purified immunoglobulin, buffered aqueous solution

Synonym: KIAP, LIVIN, ML-IAP, MLIAP, RNF50

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, B-BI, Primary Antibodies
conjugate   unconjugated
clone   3H1, monoclonal
biological source   mouse
application(s)   capture ELISA: suitable
  immunofluorescence: suitable
  indirect ELISA: suitable
species reactivity   human
mol wt   antigen ~36.01 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2aκ
Quality Level   100
antibody product type   primary antibodies
NCBI accession no.   NM_139317
UniProt accession no.   Q96CA5
Gene Information   human ... BIRC7(79444)

Description

General description

The protein encoded by this gene is a member of the family of inhibitor of apoptosis proteins (IAP) and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Two transcript variants encoding different isoforms have been found for this gene. The two isoforms have different antiapoptotic properties, with isoform alpha protecting cells from apoptosis induced by staurosporine and isoform b protecting cells from apoptosis induced by etoposide. (provided by RefSeq)

Immunogen

BIRC7 (NP_647478.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?