• USA Home
  • SAB1403875 - Monoclonal Anti-GNRH1, (C-terminal) antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1403875 Sigma-Aldrich

Monoclonal Anti-GNRH1, (C-terminal) antibody produced in mouse

clone 1C2, ascites fluid

Synonym: GNRH, GRH, LHRH, LNRH

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, GM-GO, Primary Antibodies
conjugate   unconjugated
clone   1C2, monoclonal
biological source   mouse
application(s)   indirect ELISA: suitable
  western blot: 1-5 μg/mL
species reactivity   human
mol wt   antigen ~33.7 kDa
shipped in   dry ice
storage temp.   −20°C
antibody form   ascites fluid
isotype   IgMκ
antibody product type   primary antibodies
NCBI accession no.   NM_000825
UniProt accession no.   P01148
Gene Information   human ... GNRH1(2796)

Description

Immunogen

GNRH1 (NP_000816, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

Physical form

Clear solution

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?