• USA Home
  • SAB1404010 - Monoclonal Anti-KLRC1, (N-terminal) antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1404010 Sigma-Aldrich

Monoclonal Anti-KLRC1, (N-terminal) antibody produced in mouse

clone 2C3, ascites fluid

Synonym: CD159A, MGC13374, MGC59791, NKG2, NKG2A

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, KL-KY, Primary Antibodies
conjugate   unconjugated
clone   2C3, monoclonal
biological source   mouse
application(s)   immunoprecipitation (IP): suitable
  indirect ELISA: suitable
species reactivity   human
mol wt   antigen ~33.81 kDa
shipped in   dry ice
storage temp.   −20°C
antibody form   ascites fluid
isotype   IgG1κ
antibody product type   primary antibodies
NCBI accession no.   NM_213658
UniProt accession no.   P26715
Gene Information   human ... KLRC1(3821)

Description

General description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed. (provided by RefSeq)

Immunogen

KLRC1 (NP_998823, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK

Physical form

Clear solution

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?