• USA Home
  • SAB1404211 - Monoclonal Anti-PKLR, (C-terminal) antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1404211 Sigma-Aldrich

Monoclonal Anti-PKLR, (C-terminal) antibody produced in mouse

clone 4E12, purified immunoglobulin, buffered aqueous solution

Synonym: PK1, PKL, PKR, PKRL, RPK

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, PJ-PN, Primary Antibodies
conjugate   unconjugated
clone   4E12, monoclonal
biological source   mouse
application(s)   indirect ELISA: suitable
species reactivity   human
mol wt   antigen ~36.01 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2bκ
antibody product type   primary antibodies
NCBI accession no.   BC025737
UniProt accession no.   P30613
Gene Information   human ... PKLR(5313)

Description

General description

The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

PKLR (AAH25737, 485 a.a. ~ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis

???PDP_SDS_LOT_NUMBER_ERROR_MSG???
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?