• USA Home
  • SAB1404452 - Monoclonal Anti-TCF3, (C-terminal) antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1404452 Sigma-Aldrich

Monoclonal Anti-TCF3, (C-terminal) antibody produced in mouse

clone 5G2, ascites fluid

Synonym: E2A, ITF1, MGC129647, MGC129648, bHLHb21

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, TC-TE
conjugate   unconjugated
clone   5G2, monoclonal
biological source   mouse
application(s)   indirect ELISA: suitable
  western blot: 1:500-1:1000
species reactivity   human
mol wt   antigen ~38.21 kDa
shipped in   dry ice
storage temp.   −20°C
antibody form   ascites fluid
isotype   IgG2bκ
Quality Level   100
antibody product type   primary antibodies
NCBI accession no.   NM_003200
UniProt accession no.   P15923
Gene Information   human ... TCF3(6929)

Description

General description

The TCF3 gene, also called E2A, encodes 2 basic helix-loop-helix (bHLH) transcription factors, E12 and E47, through alternative splicing. E12 and E47 are involved in regulation of immunoglobulin gene expression (Bain et al., 1994 [PubMed 8001125]).[supplied by OMIM

Immunogen

TCF3 (NP_003191, 545 a.a. ~ 654 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM

Physical form

Clear solution

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?