• USA Home
  • SAB1405115 - Monoclonal Anti-CSNK1G1 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1405115 Sigma-Aldrich

Monoclonal Anti-CSNK1G1 antibody produced in mouse

clone 2E10, purified immunoglobulin, buffered aqueous solution

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CS-CS, Primary Antibodies
conjugate   unconjugated
clone   2E10, monoclonal
biological source   mouse
application(s)   capture ELISA: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
species reactivity   human
mol wt   antigen ~37.11 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG3κ
antibody product type   primary antibodies
NCBI accession no.   BC017236
UniProt accession no.   Q9HCP0
Gene Information   human ... CSNK1G1(53944)

Description

General description

Casein kinase I is the most abundant serine/threonine kinase in eukaryotic cell extracts. Multiple isoforms of the enzyme exist. The gamma-1 isoform is involved in growth and morphogenesis of eukaryotic cells.[supplied by OMIM

Immunogen

CSNK1G1 (AAH17236, 293 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?