• USA Home
  • SAB1407409 - Anti-CD209 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1407409 Sigma-Aldrich

Anti-CD209 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonym: CDSIGN, CLEC4L, DC-SIGN1, DC-SIGN, MGC129965

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CD0-CDC, Primary Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   mouse
application(s)   western blot: 1 μg/mL
species reactivity   human
mol wt   antigen ~45.8 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
antibody product type   primary antibodies
NCBI accession no.   NM_021155
UniProt accession no.   Q9NNX6
Gene Information   human ... CD209(30835)

Description

General description

Cluster of differentiation 209 (CD209), also known as dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin (DC-SIGN), is part of the innate immune system. It is expressed by intestinal dendritic cells and alveolar macrophages. The gene encoding this C-type lectin contains seven exons and is localized on human chromosome 19p13.2.

This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

Immunogen

CD209 (NP_066978.1, 1 a.a. ~ 404 a.a) full-length human protein.

Sequence
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Physical form

Solution in phosphate buffered saline, pH 7.4

Biochem/physiol Actions

Cluster of differentiation 209 (CD209) mediates viral infection and activates immune responses. It activates T-cells and aids in their growth. The protein recognizes various pathogens and triggers immunosuppressive reactions.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Coronavirus COVID-19 (SARS-CoV-2) Detection, Characterization & Vaccine Production

As a global life science tools and equipment supplier, we are here to help in the response to COVID-19. From supplying raw materials and research products for detection and characterization to produc...
Keywords: PAGE

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?