• USA Home
  • SAB1408742 - Monoclonal Anti-GDF11 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1408742 Sigma-Aldrich

Monoclonal Anti-GDF11 antibody produced in mouse

clone 1E11, purified immunoglobulin, buffered aqueous solution

Synonym: BMP-11, BMP11

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, GD-GL, Primary Antibodies
conjugate   unconjugated
clone   1E11, monoclonal
biological source   mouse
application(s)   indirect ELISA: suitable
species reactivity   human
mol wt   antigen 36.52 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2aκ
Quality Level   100
antibody product type   primary antibodies
NCBI accession no.   NM_005811
UniProt accession no.   O95390
Gene Information   human ... GDF11(10220)

Description

General description

The protein encoded by this gene is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development. (provided by RefSeq)

Immunogen

GDF11 (NP_005802, 310 a.a. ~ 407 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

As implied by their name, bone morphogenetic proteins (BMPs) promote and regulate bone development, growth, remodeling and repair, in both prenatal development and postnatal growth of eye, heart, kidney, skin, and other tissues. They also enhance protein degradation and reduce skeletal muscle protein synthesis. BMP-11 may have a role in the development of the nervous system in mice. It acts as a modulator of development and differentiation. In mice, circulating levels of BMP-11 decrease with age.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?