• USA Home
  • SAB1409246 - Monoclonal Anti-IL8 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1409246 Sigma-Aldrich

Monoclonal Anti-IL8 antibody produced in mouse

clone 4E3, purified immunoglobulin, buffered aqueous solution

Synonym: CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, IH-IM, Primary Antibodies
conjugate   unconjugated
clone   4E3, monoclonal
biological source   mouse
application(s)   immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
species reactivity   human
mol wt   antigen 8.69 kDa
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2bκ
Quality Level   100
antibody product type   primary antibodies
NCBI accession no.   BC013615
Gene Information   human ... IL8(3576)

Description

General description

Interleukin 8 (IL-8) is an 8& kDa, 72 amino acid residue containing cytokine that belongs to C-X-C chemokine family. The IL-8 gene is mapped to human chromosomes 4q13.3. IL-8 chemokine is secreted by several cell types. The IL-8 gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection.

Immunogen

IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.

Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Physical form

Solution in phosphate buffered saline, pH 7.4

Biochem/physiol Actions

Elevated expression of IL-8 gene is observed in a number of cancers including chronic spontaneous urticaria and breast cancer, thus serves as a prognostic marker for the same. IL-8 regulates the metastasis and angiogenesis processes during cancer development. IL-8 is responsible for epithelial–mesenchymal transition which plays an important role in providing cancer cells the mobility to invade other neighbouring cells, thereby contributing to metastasis.

Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
WGK 3
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?