• USA Home
  • SAB2109002 - Anti-HTR2B (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2109002 Sigma-Aldrich

Anti-HTR2B (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: 5-HT(2B), 5-HT2B

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, HP-HT, Primary Antibodies
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: 1 μg/mL
species reactivity   human, mouse
species reactivity (predicted by homology)   pig, canine, guinea pig, human, horse, bovine
mol wt   54 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg/mL
NCBI accession no.   NM_000867
Gene Information   human ... HTR2B(57396)

Description

General description

Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognized. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.

Immunogen

Synthetic peptide directed towards the N terminal region of human HTR2B

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sequence

Synthetic peptide located within the following region: QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK

Safety & Documentation

Safety Information

WGK Germany 
nwg
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?