• USA Home
  • SAB2109080 - Anti-ULK1 (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2109080 Sigma-Aldrich

Anti-ULK1 (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: ATG1, ATG1A, UNC51, Unc51.1, hATG1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, UH-UZ
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: 1 μg/mL
species reactivity   human
species reactivity (predicted by homology)   bovine, guinea pig, rabbit, horse, human, mouse, canine, rat
mol wt   112 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg/mL
NCBI accession no.   NM_003565
Gene Information   human ... ULK1(57396)

Description

General description

ULK1 is a serine/threonine-protein kinase involved in autophagy in response to starvation. It acts upstream of phosphatidylinositol 3-kinase PIK3C3 to regulate the formation of autophagophores, the precursors of autophagosomes. Part of regulatory feedback loops in autophagy: acts both as a downstream effector and negative regulator of mammalian target of rapamycin complex 1 (mTORC1) via interaction with RPTOR. It is activated via phosphorylation by AMPK and also acts as a regulator of AMPK by mediating phosphorylation of AMPK subunits PRKAA1, PRKAB2 and PRKAG1, leading to negatively regulate AMPK activity. It may phosphorylate ATG13/KIAA0652 and RPTOR; however such data need additional evidences and plays a role early in neuronal differentiation and is required for granule cell axon formation.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human ULK1

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sequence

Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL

Safety & Documentation

Safety Information

WGK Germany 
nwg
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable

Documents

Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?