• USA Home
  • SAB2109093 - Anti-Sgms1 antibody produced in rabbit

SAB2109093 Sigma-Aldrich

Anti-Sgms1 antibody produced in rabbit


affinity isolated antibody

Synonym: 9530058O11Rik, AI841905, C80702, MGC30540, Mob



Related Categories Alphabetical Index, Antibodies, Primary Antibodies, SG-SK
conjugate   unconjugated
clone   polyclonal
biological source   rabbit
application(s)   western blot: 1 μg/mL
species reactivity   mouse
species reactivity (predicted by homology)   human, rat, horse, rabbit, bovine, canine, guinea pig, mouse
mol wt   46 kDa
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
antibody form   affinity isolated antibody
antibody product type   primary antibodies
concentration   0.5 mg/mL
NCBI accession no.   NM_144792
Gene Information   human ... SGMS1(57396)


General description

Bidirectional lipid cholinephosphotransferase is capable of converting phosphatidylcholine (PC) and ceramide to sphingomyelin (SM) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphocholine acceptors. Sgms1 directly and specifically recognizes the choline head group on the substrate. It also requires two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. Sgms1 does not function strictly as a SM synthase and suppresses BAX-mediated apoptosis and also prevents cell death in response to stimuli such as hydrogen peroxide, osmotic stress, elevated temperature and exogenously supplied sphingolipids. Sgms1 may protect against cell death by reversing the stress-inducible increase in levels of proapoptotic ceramide.


Synthetic peptide directed towards the middle region of Mouse Sgms1

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Synthetic peptide located within the following region: LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL

Safety & Documentation

Safety Information

Safety Information for this product is unavailable at this time.


Certificate of Analysis (COA)

Please Enter a Lot Number
Protocols & Articles


Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?