• USA Home
  • WH0000332M1 - Monoclonal Anti-BIRC5 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0000332M1 Sigma-Aldrich

Monoclonal Anti-BIRC5 antibody produced in mouse

clone 5B10, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-API4, Anti-EPR1, Anti-baculoviral IAP repeat-containing 5 (survivin)

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Apoptosis, Antibodies for Cell Biology, Antibodies to Suppressors of Apoptosis,
species reactivity   human
application(s)   immunofluorescence: suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
clone   5B10, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG2aκ
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... BIRC5(332)
biological source   mouse
antibody product type   primary antibodies
conjugate   unconjugated
GenBank® accession no.   NM_001168
UniProt accession no.   O15392

Description

Immunogen

BIRC5 (NP_001159, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE

General description

This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts are involved in the regulation of this gene′s expression. At least four transcript variants encoding distinct isoforms have been found for this gene, but the full-length natures of only three of them have been determined. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biochem/physiol Actions

BIRC5 (Baculoviral inhibitor of apoptosis repeat-containing 5) functions as a cell surface receptor for factor Xa. It is predicted to be a potential factor in protease-dependent cellular effector functions. It also behaves as a receptor for factor Xa during the cell surface assembly of proteolytic activities and leukocyte mitogenesis. A study reports that the expression of BIRC5 can be controlled by mRNA splicing. It is an inhibitor of apoptosis and is expressed in various malignancies.

Safety & Documentation
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?