• USA Home
  • WH0001104M1 - Monoclonal Anti-RCC1 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0001104M1 Sigma-Aldrich

Monoclonal Anti-RCC1 antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CHC1, Anti-RCC1I, Anti-regulator of chromosome condensation 1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, RB-RG
conjugate   unconjugated
clone   2F1, monoclonal
biological source   mouse
application(s)   immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
species reactivity   human
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG1κ
antibody product type   primary antibodies
GenBank® accession no.   BC007300
UniProt accession no.   P18754
Gene Information   human ... RCC1(1104)

Description

General description

Regulator of chromosome condensation 1 (RCC1) is a nuclear guanine nucleotide exchange factor for the small GTPase Ran enzyme. The gene is located on human chromosome 1p35.3. It is a 45 kDa protein.

Immunogen

RCC1 (AAH07300, 312 a.a. ~ 421 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Biochem/physiol Actions

Regulator of chromosome condensation 1 (RCC1) interacts with chromatin and contributes to the formation of RanGTP gradients, which is required for nucleo-cytoplasmic transport, mitotic spindle formation and nuclear envelope reassembly following mitosis. It is an important cell cycle regulator. The protein functions as a tumor suppressor in gastric carcinoma.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?