• USA Home
  • WH0001434M1 - Monoclonal Anti-CSE1L antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0001434M1 Sigma-Aldrich

Monoclonal Anti-CSE1L antibody produced in mouse

clone 2B7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CAS, Anti-CSE1 chromosome segregation 1-like (yeast), Anti-CSE1, Anti-XPO2

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CS-CS, Primary Antibodies
conjugate   unconjugated
clone   2B7, monoclonal
biological source   mouse
application(s)   ELISA: suitable
  immunofluorescence: suitable
  western blot: 1-5 μg/mL
species reactivity   human
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG1κ
antibody product type   primary antibodies
GenBank® accession no.   NM_001316
UniProt accession no.   P55060
Gene Information   human ... CSE1L(1434)

Description

General description

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. (provided by RefSeq)

Immunogen

CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?