• USA Home
  • WH0002672M1 - Monoclonal Anti-GFI1 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0002672M1 Sigma-Aldrich

Monoclonal Anti-GFI1 antibody produced in mouse

clone 3G8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ZNF163, Anti-growth factor independent 1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, GA - HN,
conjugate   unconjugated
clone   3G8, monoclonal
biological source   mouse
application(s)   immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
species reactivity   human
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG1κ
antibody product type   primary antibodies
GenBank® accession no.   NM_005263
UniProt accession no.   Q99684
Gene Information   human ... GFI1(2672)

Description

General description

This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene. (provided by RefSeq)

Immunogen

GFI1 (NP_005254, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport

Documents

Certificate of Analysis

Please Enter a Lot Number

Certificate of Origin

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?