• USA Home
  • WH0003645M1 - Monoclonal Anti-INSRR antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0003645M1 Sigma-Aldrich

Monoclonal Anti-INSRR antibody produced in mouse

clone 6E6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-IRR, Anti-insulin receptor-related receptor

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Kinase/Phosphatase Biology, Antibodies to Hormones,
conjugate   unconjugated
clone   6E6, monoclonal
biological source   mouse
application(s)   immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
species reactivity   human
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG1κ
Quality Level   100
antibody product type   primary antibodies
GenBank® accession no.   NM_014215
UniProt accession no.   P14616
Gene Information   human ... INSRR(3645)

Description

General description

The gene INSRR (insulin receptor related receptor) is mapped to human chromosome 1q21-q23. It belongs to the insulin receptor family of proteins. INSRR is mainly present in organs which are associated with acid/base generation. The protein has two N-terminal leucine-rich repeat domains, a cysteine-rich C domain and three C-terminal fibronectin type-III repeats.

Immunogen

INSRR (NP_055030, 651 a.a. ~ 760 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDF

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Biochem/physiol Actions

INSRR (insulin receptor related receptor) exhibits pH-sensing property and is a sensor for mild alkaline extracellular medium. In mice, it is associated with excessive excretion of base by the kidneys.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?