• USA Home
  • WH0004899M1 - Monoclonal Anti-NRF1 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0004899M1 Sigma-Aldrich

Monoclonal Anti-NRF1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ALPHAPAL, Anti-nuclear respiratory factor 1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, NC - PB,
conjugate   unconjugated
clone   2F9, monoclonal
biological source   mouse
application(s)   immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
species reactivity   human
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG1κ
antibody product type   primary antibodies
GenBank® accession no.   NM_005011
UniProt accession no.   Q16656
Gene Information   human ... NRF1(4899)

Description

General description

This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for "nuclear factor (erythroid-derived 2)-like 1" which has an official symbol of NFE2L1. (provided by RefSeq)

Immunogen

NRF1 (NP_005002, 201 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPWANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQ

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport

Documents

Certificate of Analysis

Please Enter a Lot Number

Certificate of Origin

Please Enter a Lot Number
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?