• USA Home
  • WH0009641M2 - Monoclonal Anti-IKBKE antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0009641M2 Sigma-Aldrich

Monoclonal Anti-IKBKE antibody produced in mouse

clone 2F1, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-IKKE, Anti-IKKI, Anti-IKKi, Anti-KIAA0151, Anti-MGC125294, Anti-MGC125295, Anti-MGC125297, Anti-inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Gene Regulation and Expression, Antibodies to Transcription Regulators,
conjugate   unconjugated
clone   2F1, monoclonal
biological source   mouse
application(s)   indirect ELISA: suitable
species reactivity   human
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG1κ
antibody product type   primary antibodies
GenBank® accession no.   NM_014002
UniProt accession no.   Q14164
Gene Information   human ... IKBKE(9641)

Description

General description

Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε ) is encoded by the gene mapped to human chromosome 1q32.1. IKKε is a serine/threonine protein kinase, which belongs to the non-canonical IκB kinase family. IKKε is an ~85kDa protein characterized with kinase domain close to N-terminal end, coiled-coil motif, and putative helix-loop-helix (HLH) motif close to C-terminal end.

Immunogen

IKBKE (NP_054721, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Biochem/physiol Actions

Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε) mainly activates the canonical nuclear factor-κB (NF-κB) pathway induced by interferon, phorbol 12-myristate 13-acetate, or the T-cell receptor. Overexpression of IKKε is associated with the pathogenesis of a subset of breast tumors and ovarian cancer. IKBKE also acts as a potential therapeutic target for these malignancies. IKKε plays a vital role in regulation of immune response. IKKε is an essential constituent of a novel IκB kinase complex, which is mainly implicated in the degradation of IκBα in response to either phorbol esters (PMA) or to T cell receptor activation. IKKε activated by interferon-β (IFNβ), directly phosphorylates signal transducer and activator of transcription 1 (STAT1), a component of interferon-stimulated gene factor 3 complex (ISGF3), and thus, plays a vital role in IFN-inducible antiviral transcriptional response.

Safety & Documentation
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?