• USA Home
  • WH0011102M1 - Monoclonal Anti-RPP14 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0011102M1 Sigma-Aldrich

Monoclonal Anti-RPP14 antibody produced in mouse

clone 3H4, ascites fluid

Synonym: Anti-P14, Anti-ribonuclease P 14kDa subunit

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to RNA Binding Proteins, Primary Antibodies,
species reactivity   human
application(s)   ELISA: suitable
  western blot: 1:500-1:1000
clone   3H4, monoclonal
antibody form   ascites fluid
isotype   IgG2aκ
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... RPP14(11102)
biological source   mouse
antibody product type   primary antibodies
conjugate   unconjugated
GenBank® accession no.   NM_007042
UniProt accession no.   O95059

Description

Immunogen

RPP14 (NP_008973, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL

Physical form

Solution

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Safety & Documentation
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary and Secondary Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay needs. Use the Antibody...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?