• USA Home
  • WH0051284M4 - Monoclonal Anti-TLR7 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0051284M4 Sigma

Monoclonal Anti-TLR7 antibody produced in mouse

clone 2C9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-toll-like receptor 7

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to RNA Binding Proteins, Epigenetics, Primary Antibodies,
species reactivity   rat, mouse, human
application(s)   indirect ELISA: suitable
  western blot: 1-5 μg/mL
clone   2C9, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG2bκ
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... TLR7(51284)
biological source   mouse
conjugate   unconjugated
GenBank® accession no.   NM_016562

Description

Immunogen

TLR7 (NP_057646, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGL

General description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung, placenta, and spleen, and lies in close proximity to another family member, TLR8, on chromosome X. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability


Antibody Explorer
Safety & Documentation
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Search & filter by validated application (ie, WB, IF/ICC, IHC, ELISA, etc,) host species, clonality (monoclonal, polyclonal and recombinant) and more. Learn from technical information, product highli...
Keywords: Amplification, Buffers, Enzyme-linked immunosorbent assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?