• USA Home
  • WH0055676M1 - Monoclonal Anti-SLC30A6 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0055676M1 Sigma-Aldrich

Monoclonal Anti-SLC30A6 antibody produced in mouse

clone 2G6-G3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-FLJ31101, Anti-MGC45055, Anti-ZNT6, Anti-solute carrier family 30 (zinc transporter), member 6

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to Drug Transport Proteins, Biochemicals and Reagents, Drug Transport Proteins & Reagents,
conjugate   unconjugated
clone   2G6-G3, monoclonal
biological source   mouse
application(s)   indirect ELISA: suitable
species reactivity   human
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2aκ
antibody product type   primary antibodies
GenBank® accession no.   BC032525
UniProt accession no.   Q6NXT4
Gene Information   human ... SLC30A6(55676)

Description

General description

Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such as SLC30A6, permit cellular efflux of zinc (Seve et al., 2004 [PubMed 15154973]).[supplied by OMIM

Immunogen

SLC30A6 (AAH32525, 1 a.a. ~ 216 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
nwg
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?