• USA Home
  • WH0057804M1 - Monoclonal Anti-POLD4 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0057804M1 Sigma-Aldrich

Monoclonal Anti-POLD4 antibody produced in mouse

clone 2B11, ascites fluid

Synonym: Anti-POLDS, Anti-p12, Anti-polymerase (DNA-directed), delta 4

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, POD-POZ, Primary Antibodies
conjugate   unconjugated
clone   2B11, monoclonal
biological source   mouse
application(s)   indirect ELISA: suitable
  western blot: 1:500-1:1000
species reactivity   human
shipped in   dry ice
storage temp.   −20°C
antibody form   ascites fluid
isotype   IgG2bκ
Quality Level   100
antibody product type   primary antibodies
GenBank® accession no.   BC001334
UniProt accession no.   Q9HCU8
Gene Information   human ... POLD4(57804)

Description

General description

DNA polymerase δ 4 (POLD4), also known as p12, is the smallest subunit of DNA polymerase (Pol) δ. It is encoded by the gene mapped to human chromosome 11q13.2.

The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).

Immunogen

POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL

Physical form

Solution

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Biochem/physiol Actions

DNA polymerase (Pol) δ plays a vital role in DNA replication, DNA repair processes and genetic recombination. POLD4 stabilizes the Pol δ holoenzyme. In addition, it also facilitates pol δ-PCNA complex stabilization. Proteolysis of POLD4 in response to DNA damage leads to the consequent conversion of the holoenzyme pol δ4 to the heterotrimer pol δ3. Pol δ3 acts as an antimutator polymerase and is supposed to enhance surveillance against mutagenesis. Downregulated expression of the gene is associated with the genomic instability in lung cancer.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
nwg
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detection methods, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?