• USA Home
  • WH0057822M1 - Monoclonal Anti-GRHL3 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0057822M1 Sigma

Monoclonal Anti-GRHL3 antibody produced in mouse

clone 3C5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-MGC46624, Anti-SOM, Anti-TFCP2L4, Anti-grainyhead-like 3 (Drosophila)

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to Transcription Factors, Epigenetics, GA - HN,
species reactivity   human
application(s)   indirect ELISA: suitable
  western blot: 1-5 μg/mL
clone   3C5, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG2aκ
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... GRHL3(57822)
biological source   mouse
conjugate   unconjugated
GenBank® accession no.   NM_021180

Description

Immunogen

GRHL3 (NP_067003, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALPTPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVPPTQRWQPD

General description

Grainyhead-like 3 (GRHL3), also known as GET1, is encoded by the gene mapped to human chromosome 1p36.11. GRHL3 is one of the mammalian homologues of Grh gene.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

Grainyhead-like 3 (GRHL3) stimulates gene expression programs involved in various cellular processes, such as cell adhesion, lipid production, cornified envelope formation and protein crosslinking. In addition, it also facilitates keratinocyte migration during eyelid closure and wound healing. Missense mutation in the gene is associated with the development of nonsyndromic cleft palate. In addition, variation in the gene also leads to Van der Woude syndrome (VWS). The protein expression can be used as a diagnostic factor for germinal center B cell (GCB) /non-GCB of diffuse large B cell lymphoma.

Safety & Documentation
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Protocols

Western Blot Protocol | Immunoblotting Protocol

Western Blotting refers to the electrophoretic transfer of proteins from sodium dodecyl sulfate polyacrylamide gels to sheets of PVDF or nitrocellullose membrane, followed by immunodetection of prote...
Keywords: AGE, Buffers, Cell disruption, Detergents, Dialysis, Electroblotting, Electrophoresis, Enzyme activity, Gel electrophoresis, Immunoprecipitation, PAGE, Protein extraction, Purification, Sample preparations, Western blot

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Search & filter by validated application (ie, WB, IF/ICC, IHC, ELISA, etc,) host species, clonality (monoclonal, polyclonal and recombinant) and more. Learn from technical information, product highli...
Keywords: Amplification, Buffers, Enzyme-linked immunosorbent assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?