• USA Home
  • WH0148581M7 - Monoclonal Anti-UBE2U antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0148581M7 Sigma-Aldrich

Monoclonal Anti-UBE2U antibody produced in mouse

clone 3D4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ubiquitin-conjugating enzyme E2U (putative), Anti-MGC35130, Anti-RP4636O23.1

  •  NACRES NA.41

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, U1-UG
conjugate   unconjugated
clone   3D4, monoclonal
biological source   mouse
application(s)   immunofluorescence: suitable
  indirect ELISA: suitable
species reactivity   human
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
antibody form   purified immunoglobulin
isotype   IgG2aκ
Quality Level   100
antibody product type   primary antibodies
GenBank® accession no.   NM_152489.1
UniProt accession no.   Q5VVX9
Gene Information   human ... UBE2U(148581)

Description

General description

UBE2U (Ubiquitin-conjugating enzyme E2U) is an E2 enzyme belonging to the class III group of UbcH5 family of highly homologous E2s family. It consists of an extended C-terminal tail region attached to its UBC-fold. Its mRNA expression has been reported in the urogenital tract.

Immunogen

UBE2U (NP_689702.1, 9 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTN

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Biochem/physiol Actions

UBE2U (Ubiquitin-conjugating enzyme E2U) plays a vital role in the formation of E2-RING E3 network in the human ubiquitin-proteasome system. It acts as a hub protein in direct interaction with E3 ligase, MDM2. It links and holds E2-E3 network together for the ubiquitination activity, which finally transfer the ubiquitin to the E3-bound substrate. The protein also plays a role in the protein degradation process of misfolded and short-lived proteins.

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
nwg
Flash Point(F) 
Not applicable
Flash Point(C) 
Not applicable
Protocols & Articles

Articles

Antibody Basics

Immunoglobulins (Igs) are produced by B lymphocytes and secreted into plasma. The Ig molecule in monomeric form is a glycoprotein with a molecular weight of approximately 150 kDa that is shaped more ...
Keywords: Affinity chromatography, Centrifugation, Chromatography, Digestions, Direct immunofluorescence, Gene expression, High performance liquid chromatography, Immunofluorescence, Ion Exchange, Microscopy, Precipitation, Purification, Rheumatology, Scanning electron microscopy

Related Content

Antibody Explorer | Buy Primary Antibodies & Secondary Antibodies

Primary, Secondary and Recombinant Monoclonal Antibodies Providing highly cited primary and secondary antibodies, we have you covered for your ELISA, western blot, immunohistochemistry or other assay...
Keywords: Alzheimer Disease, Cancer, Chromatin immunoprecipitation, Diagnostic, Enzyme-linked immunosorbent assay, Flow cytometry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Neuroscience, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?