Documentos clave

Ver Toda la documentación

Saltar a

HPA018919

Anti-MDM4 antibody produced in rabbit

Name: Anti-MDM4 antibody produced in rabbit
Brand: SIGMA
Price: 514 EUR

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-HDMX, Anti-MDMX

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño

Cambiar Vistas

Talla/SKU	Disponibilidad	Precio
100 μL	Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad	514,00 €

Acerca de este artículo

UNSPSC Code:

12352203

NACRES:

NA.43

MDL number:

MFCD00282354

Human Protein Atlas Number:

HPA018919

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

514,00 €

Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Servicio técnico

¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.

Permítanos ayudarle

Propiedades

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

SFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRTTEDDIPTLP

UniProt accession no.

O15151

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MDM4(4194)

Descripción

General description

The gene MDM4 (double minute 4 protein) is mapped to human chromosome 1q32. It belongs to MDM2 gene family and RING (really interesting new gene)-domain superfamily. MDM4 is also called as MDMX.

Immunogen

MDM4, p53 regulator

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

MDM4 (Double minute 4 protein) is an oncoprotein which interacts with tumor suppressor protein, p53, and regulates p53 activation. MDM4 can form heterodimer with another member of the family, MDM2. Interaction with MDM2 strengthens MDM2 ability to suppress p53 by ubiquitination. MDM4 also works independently of p53 and results in genomic instability by inhibiting double-strand DNA break repair and DNA-damage response signaling. It is up-regulated in hepatocellular carcinoma, lung cancer, stomach cancer, breast cancer and retinoblastomas.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST74262

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Comparar elementos similares

Ver comparación completa

Mostrar Diferencias

1 of 1

Este artículo	HPA048821	SAB4501852	M0445
Sigma-Aldrich HPA018919 Anti-MDM4 antibody produced in rabbit	Sigma-Aldrich HPA048821 Anti-MDM4 antibody produced in rabbit	Sigma-Aldrich SAB4501852 Anti-MDM4 antibody produced in rabbit	Sigma-Aldrich M0445 Anti-MDMX antibody, Mouse monoclonal
description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution	description Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody	description affinity isolated antibody	description clone MDMX-82, purified from hybridoma cell culture
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form purified immunoglobulin
biological source rabbit	biological source rabbit	biological source rabbit	biological source mouse
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 200
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line -
clone polyclonal	clone polyclonal	clone polyclonal	clone MDMX-82, monoclonal

Still not finding the right product?

Explore all of our products under Anti-MDM4 antibody produced in rabbit

— o —

Pruebe nuestra Herramienta de selección de productos para limitar sus opciones

Clase de almacenamiento

10 - Combustible liquids

¿Qué está pasando?

WGK 1

Punto de inflamación (°F)

Not applicable

Punto de inflamación (°C)