Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
NACRES:
NA.28
Form:
lyophilized
Mol wt:
33.3 kDa
Quality Segment
form
lyophilized
shelf life
2 yr (Retest)
mol wt
33.3 kDa
sequence note
SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQ
NCBI accession no.
shipped in
dry ice
storage temp.
-10 to -25°C
General description
Mpro, 3CL is a critical enzyme for the coronavirus life cycle. It activity yield non-structural proteins that are crucial for genome replication and Coronavirus virion production: RNA-dependent RNA polymerase, a helicase, ribonucleases and 3CLpro itself, from two types of polyproteins (pp1a and pp1ab). The maturation of MERS coronavirus depends on cleavage of the overlapping large polyproteins 1a and 1ab by two viral proteases:
MERS Mpro, 3CL exists as a homodimer and each protomer has an active site. The proteolytic cleavage of 1ab polyprotein by Mpro occurs at 11 sites: 7 sites within the 1a polyprotein, and 11 sites within the 1ab polyprotein. This results in maturation of 16 viral non-structural proteins.Mpro protease forms a functional homodimer. Both the N-terminus and the C- terminus of Mpro have been shown to be critical for dimer formation and for enzyme function.
The Mpro protease, 3CLpro is an ideal target for antiviral drug design due to its high conservation between different coronavirus strains and absence of functional analogs in the human proteome. Mpro protease from SARS, MERS and SARS-CoV2 coronaviruses are functionally identical.
- Mpro (main protease)
- PLpro (Papain-like protease)
MERS Mpro, 3CL exists as a homodimer and each protomer has an active site. The proteolytic cleavage of 1ab polyprotein by Mpro occurs at 11 sites: 7 sites within the 1a polyprotein, and 11 sites within the 1ab polyprotein. This results in maturation of 16 viral non-structural proteins.Mpro protease forms a functional homodimer. Both the N-terminus and the C- terminus of Mpro have been shown to be critical for dimer formation and for enzyme function.
The Mpro protease, 3CLpro is an ideal target for antiviral drug design due to its high conservation between different coronavirus strains and absence of functional analogs in the human proteome. Mpro protease from SARS, MERS and SARS-CoV2 coronaviruses are functionally identical.
Features and Benefits
Mpro, 3CL Protease (3C-like protease) is the main protease of Human MERS Coronavirus.
Mpro 3CL Protease is a cysteine protease. Mpro protease cleaves proteins with sequences including LQ[S/A/G) c-terminal to the glutamine residue.
Mpro 3CL Protease is a cysteine protease. Mpro protease cleaves proteins with sequences including LQ[S/A/G) c-terminal to the glutamine residue.
Physical form
The product is supplied lyophilized from 20 mM HEPES, 2.5% Trehalose, and 0.05% Tween 20.
This product contains the complete sequence of Mpro protease [Uniprot No.: W5ZZQ8 (3248- 3553)] without any additional tags. The product is supplied lyophilized from 20 mM HEPES, 2.5% Trehalose, and 0.05% Tween 20.
This product contains the complete sequence of Mpro protease [Uniprot No.: W5ZZQ8 (3248- 3553)] without any additional tags. The product is supplied lyophilized from 20 mM HEPES, 2.5% Trehalose, and 0.05% Tween 20.
Signal Word
Danger
Hazard Codes
Precautionary Statements
Hazard Classifications
Resp. Sens. 1
Storage Class
11 - Combustible Solids
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
