5100

CD164 human

recombinant, expressed in E. coli, 0.5 mg protein/mL

• NACRES: NA.75
• UNSPSC Code: 12352200
• Form: liquid
• Assay: ≥90% (SDS-PAGE)
• Biological source: human
• Recombinant: expressed in E. coli

Eigenschaften

• biological source: human
• recombinant: expressed in E. coli
• description: 0.05 mg of recombinant human CD164 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
• sterility: Filtered sterilized solution
• assay: ≥90% (SDS-PAGE)
• form: liquid
• packaging: pkg of 50 μg
• concentration: 0.5 mg protein/mL
• accession no.: NP_006007
• UniProt accession no.: Q04900
• storage temp.: −20°C
• Gene Information: human ... CD164(8763)

Beschreibung

Application

Coating a plate well (6 well plate) with this recombinant CD164 matrix protein in HSC cell specific medium at 1-10 μg/well allows for human HSC / receptor interaction studies in vitro.

Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
Note: Use 1 ml PBS per well in a 6-well plate.
2. Add 1 - 10 μg protein to each well and incubate at 2 to 10 °C overnight.
3. After incubation, aspirate remaining material.
4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained

Preparation Note

The full-length extracellular domain of the human CD164 cDNA (24 - 162 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.

Other Notes

MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• Was ist los?: WGK 2
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable