APREST89286

PrEST Antigen GRB2

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Synonym(s): NCKAP2
• UNSPSC Code: 12352202

Properties

• recombinant: expressed in E. coli
• assay: >80% (SDS-PAGE)
• form: buffered aqueous solution
• mol wt: predicted mol wt 24 kDa
• purified by: immobilized metal affinity chromatography (IMAC)
• concentration: ≥0.5 mg/mL
• immunogen sequence: KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
• Ensembl | human accession no.: ENSG00000177885
• UniProt accession no.: P62993
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... GRB2(2885)

Description

General description

Recombinant protein fragment of Human GRB2 with N-terminal His₆ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.    

Application

Blocking agent and positive assay control using corresponding antibodies.

Physical form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Preparation Note

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Other Notes

Corresponding Antibody HPA030749.

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Safety Information

• Storage Class: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable