C8490

CRG-2 from mouse

BioReagent, recombinant, expressed in E. coli, ≥97% (SDS-PAGE), lyophilized powder, suitable for cell culture

• Sinónimos: CXCL10, Cytokine Responsive Gene 2, IP-10
• UNSPSC Code: 12352209
• NACRES: NA.75
• MDL number: MFCD01866130

Propiedades

• recombinant: expressed in E. coli
• product line: BioReagent
• assay: ≥97% (SDS-PAGE)
• form: lyophilized powder
• mol wt: predicted mol wt ~8.8 kDa
• technique(s): cell culture | mammalian: suitable
• impurities: endotoxin, tested
• UniProt accession no.: P17515
• storage temp.: −20°C
• Gene Information: mouse ... Cxcl10(15945)

Descripción

General description

Recombinant Mouse CRG-2 is produced from a DNA sequence encoding the mature mouse CRG-2/IP-10 protein sequence (MIPLARTVRCNCHIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTI KNLMKAFSQKRSKRAP). The methionyl form of the E. coli-expressed mature CRG-2 contains 78 amino acid residues and has a predicted molecular mass of approximately 8.8 kDa.

Recombinant Mouse CRG-2 (IP-10, CXCL10) is a member of the chemokine ??subfamily that lacks the ELR domain. Mouse CRG-2 cDNA encodes a 98 amino acid residue precursor protein with a 21 amino acid residue signal peptide that is cleaved to form the 77 amino acid residue secreted mature protein. Mature mouse CRG-2 shares approximately 67% amino acid sequence identity with human IP-10.

Physical form

Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4, containing 50 μg bovine serum albumin per 1 μg of cytokine

Analysis Note

The biological activity is measured by its ability to chemoattract human lymphocytes cultured in the presence of IL-2 for 21 days, or mouse BaF/3 cells transfected with hCXCR-3.

Información de seguridad

• Clase de almacenamiento: 11 - Combustible Solids
• ¿Qué está pasando?: WGK 3
• Punto de inflamación (°F): Not applicable
• Punto de inflamación (°C): Not applicable
• EPI (equipos de protección individual): Eyeshields, Gloves, type N95 (US)