SAB2108317

Anti-INSIG1 antibody produced in rabbit

affinity isolated antibody

• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC
• Citations: -

Propiedades

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 36kDa
• species reactivity: human, mouse, bovine, guinea pig, sheep, dog, horse, rat, goat, rabbit
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunoblotting: suitable, immunohistochemistry: suitable
• NCBI accession no.: NM_198336
• UniProt accession no.: A4D2M9
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... INSIG1(3638)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human INSIG1

Biochem/physiol Actions

Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane prote

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable