AV40693

Anti-SNRPD1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Small Nuclear Ribonucleoprotein D1 polypeptide 16 kDa
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: IHC, WB
• Citations: 1

Właściwości

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 13 kDa
• species reactivity: rabbit, rat, horse, mouse, human, bovine, dog, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable, western blot: suitable
• NCBI accession no.: NP_008869
• UniProt accession no.: P62314
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SNRPD1(6632)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human SNRPD1

Biochem/physiol Actions

SNRPD1 is a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.This gene encodes a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Klasa składowania: 10 - Combustible liquids
• Co się dzieje?: WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable