This product is a lyophilized powder. The purity and protein content per vial is reported on the lot specific Certificate of Analysis. Please see the link below to review the product datasheet which includes preparation instructions: https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/146/652/msqc19dat.pdf. Please see the link below to review a sample Certificate of Analysis: https://www.sigmaaldrich.com/certificates/COFA/MS/MSQC19/MSQC19-100UG______SLCD2802__.pdf
Spend R 8 500 — Save 5%; Spend R 12 250 — Save 10%; Spend R 25 250 — Save 15%*
Sign in to check eligibility. Shop Products
Select a Size
| Size/SKU | Availability | Price |
|---|---|---|
100 μg | Please contact Customer Service for Availability | R 7 320,00 R 7 173,60 |
About This Item
R 7 173,60
List PriceR 7 320,00Save 2%Save Up To 15%
recombinant
expressed in CHO cells
assay
≥90% (SDS-PAGE)
form
solid
suitability
suitable for mass spectrometry
shipped in
wet ice
storage temp.
−20°C
General description
SILu™MAb Cetuximab is for R&D use only. Not for drug, household, or other uses.
Other Notes
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™MAb Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Legal Information
1 of 1
This Item | |||
|---|---|---|---|
| description recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells | description from mouse, recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| shipped in wet ice | shipped in wet ice | shipped in wet ice | shipped in wet ice |
| form solid | form solid | form - | form - |
| assay ≥90% (SDS-PAGE) | assay ≥90% (HPLC) | assay ≥90% (SDS-PAGE) | assay ≥90% (SDS-PAGE) |
| suitability suitable for mass spectrometry | suitability suitable for mass spectrometry | suitability - | suitability - |
| recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells |
Storage Class
11 - Combustible Solids
wgk
WGK 3
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
-
What is the concentration and solubility of this product?
1 answer-
Helpful?
-



