HPA036655
Anti-HTRA1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinonimo/i:
Anti-ARMD7, Anti-HtrA, Anti-IGFBP5-protease, Anti-PRSS11
per visualizzare i prezzi organizzativi e contrattuali.
Scegli un formato
Cambia visualizzazione
| A voi/SKU | Disponibilità | Prezzo |
|---|---|---|
100 μL | Per conoscere la disponibilità, visualizza il carrello | CHF 482.00 |
Informazioni su questo articolo
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
10
CHF 482.00
Per conoscere la disponibilità, visualizza il carrello
Servizio Tecnico
Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.
Permettici di aiutartibiological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50
immunogen sequence
GSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIA
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... HTRA1(5654)
General description
The gene HTRA1 (HtrA serine peptidase 1) is mapped to human chromosome 10q26. The gene encodes a serine protease. It belongs to the HTRA family of proteins. The protein has an extracellular export signal, a IGFBP (insulin-like growth factor-binding protein) domain, a Kazal-like structure, a serine protease module and a C-terminal PDZ (PSD-95, Discs-large and ZO-1) binding motif.[1]
Immunogen
HtrA serine peptidase 1 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-HTRA1 antibody produced in rabbit has been used in immunohistochemistry.
Anti-HTRA1 antibody produced in rabbit has been used in immunohistochemistry.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
Biochem/physiol Actions
HTRA1 (HtrA serine peptidase 1) plays an important role in protein degradation and cell signaling. It is also involved in development of many organs and of various pathologies (neoplastic and degenerative diseases). HTRA1 exhibits tumor suppressor activities. Mutations in this gene are associated with two diseases, CARASIL (cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy) and AMD (age-related macular degeneration).[1]
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST79654
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
1 of 1
Questo articolo | |||
|---|---|---|---|
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| antibody form affinity isolated antibody | antibody form IgG fraction of antiserum | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies |
| shipped in wet ice | shipped in dry ice | shipped in wet ice | shipped in wet ice |
| clone polyclonal | clone polyclonal | clone polyclonal | clone polyclonal |
Still not finding the right product?
Provate il nostro Motore di ricerca dei prodotti per restringere le opzioni.
Classe di stoccaggio
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Scegli una delle versioni più recenti:
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.