This product is a lyophilized powder. The purity and protein content per vial is reported on the lot specific Certificate of Analysis. Please see the link below to review the product datasheet which includes preparation instructions: https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/146/652/msqc19dat.pdf. Please see the link below to review a sample Certificate of Analysis: https://www.sigmaaldrich.com/certificates/COFA/MS/MSQC19/MSQC19-100UG______SLCD2802__.pdf
Se connecter pour consulter les tarifs organisationnels et contractuels.
Sélectionner une taille de conditionnement
Changer de vue
| À vous/Référence | Disponibilité | Prix |
|---|---|---|
100 μg | Vérifier la disponibilité des articles du panier | 330.00 CHF |
A propos de cet article
NACRES:
NA.41
UNSPSC Code:
41105331
Clone:
-
Species reactivity:
-
Application:
—
Citations:
-
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aiderrecombinant
expressed in CHO cells
assay
≥90% (SDS-PAGE)
form
solid
suitability
suitable for mass spectrometry
shipped in
wet ice
storage temp.
−20°C
General description
SILu™MAb Cetuximab (MSQC19) is a recombinant, stable isotope-labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, it is designed to be used as an internal standard for the quantitative mass spectrometry analysis of Cetuximab in human serum.
SILu™MAb Cetuximab is for R&D use only. Not for drug, household, or other uses.
SILu™MAb Cetuximab is for R&D use only. Not for drug, household, or other uses.
Other Notes
SILu™MAb Cetuximab Heavy Chain:
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™MAb Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SILu™MAb Cetuximab Light Chain:
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Legal Information
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC
1 of 1
Cet article | |||
|---|---|---|---|
| description recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells | description - |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| form solid | form solid | form solid | form - |
| shipped in wet ice | shipped in wet ice | shipped in wet ice | shipped in wet ice |
| assay ≥90% (SDS-PAGE) | assay ≥90% (SDS-PAGE) | assay ≥90% (HPLC) | assay ≥90% (SDS-PAGE) |
| recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells |
| suitability suitable for mass spectrometry | suitability suitable for mass spectrometry | suitability suitable for mass spectrometry | suitability - |
Classe de stockage
11 - Combustible Solids
wgk
WGK 3
Faites votre choix parmi les versions les plus récentes :
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
-
What is the concentration and solubility of this product?
1 answer-
Helpful?
-



