Saltar al contenido
Merck

AV53602

Anti-LDHC antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-LDH3, Anti-LDHX, Anti-Lactate dehydrogenase C, Anti-MGC111073

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño


Acerca de este artículo

NACRES:
NA.41
UNSPSC Code:
12352203
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle

Nombre del producto

Anti-LDHC antibody produced in rabbit, affinity isolated antibody

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

36 kDa

species reactivity

rabbit, dog, horse, rat, human, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Quality Level

Gene Information

human ... LDHC(3948)

Categorías relacionadas

Application

Anti-LDHC antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

LDHC is testis-specific and acts as a key enzyme for sperm motility. It facilitates the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. Additionally, it also serves as a diagnostic marker for chronic tuberculosis. 3 LDH works to prevent muscular failure and fatigue in multiple ways.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

LDHC (lactate dehydrogenase C) gene also referred to as LDH3, LDHX or MGC111073 encodes for an enzyme that belongs to the lactate dehydrogenase family.

Immunogen

Synthetic peptide directed towards the middle region of human LDHC

Other Notes

Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

wgk

WGK 3

Clase de almacenamiento

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Tahereh Esmaeilpour et al.
Iranian journal of medical sciences, 39(1), 20-28 (2014-01-24)
Application of follicular fluid (FF) and platelet-activating factor (PAF) in artificial insemination improves sperm motility. Lactate dehydrogenase C (LDH-C) is a key enzyme for sperm motility. In this study, the effects of FF and PAF on the sperm motility index
P R Sharma et al.
Clinical biochemistry, 40(18), 1414-1419 (2007-10-16)
The objective of this investigation was to find out if sputum-positive (AFB test) test, which is performed to assess mycobacterial infection status, is anyway correlated with any of the LDH isoforms. And if so, can it be used, either alone
Fanny Odet et al.
Biology of reproduction, 79(1), 26-34 (2008-03-28)
The lactate dehydrogenase (LDH) protein family members characteristically are distributed in tissue- and cell type-specific patterns and serve as the terminal enzyme of glycolysis, catalyzing reversible oxidation reduction between pyruvate and lactate. They are present as tetramers, and one family
Lin Huang et al.
Animal biotechnology, 23(2), 114-123 (2012-04-28)
The objective of the present study was to confirm the widespread existence of alternative splicing of lactate dehydrogenase c (ldhc) gene in mammals. RT-PCR was employed to amplify cDNAs of ldhc from testes of mammals including pig, dog, rabbit, cat
Fanny Odet et al.
Biology of reproduction, 85(3), 556-564 (2011-05-14)
We demonstrated previously that disruption of the germ cell-specific lactate dehydrogenase C gene (Ldhc) led to male infertility due to defects in sperm function, including a rapid decline in sperm ATP levels, a decrease in progressive motility, and a failure

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico