SAB1404792

Monoclonal Anti-RBM6, (C-terminal) antibody produced in mouse

Name: Monoclonal Anti-RBM6, (C-terminal) antibody produced in mouse
Brand: SIGMA
Price: 580 USD

clone 4B3, purified immunoglobulin, buffered aqueous solution

Synonym(s):

3G2, DEF-3, DEF3, DKFZp686B0877, FLJ36517, HLC-11, NY-LU-12, g16

Slide 1 of 3

Select a Size

100 μG

$580.00

Ships within 2 weeks. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Key Documents

View All Documentation

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4B3, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.11 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

NM_005777

UniProt accession no.

P78332

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RBM6(10180)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	SAB1402504	SAB1400377	SAB1403202
Sigma-Aldrich SAB1404792 Monoclonal Anti-RBM6, (C-terminal) antibody produced in mouse	Sigma-Aldrich SAB1402504 Monoclonal Anti-RBM6, (C-terminal) antibody produced in mouse	$Anti-RBM6 antibody produced in mouse IgG fraction of antiserum, buffered aqueous solution$ Sigma-Aldrich SAB1400377 Anti-RBM6 antibody produced in mouse	Sigma-Aldrich SAB1403202 Monoclonal Anti-RBMS3, (C-terminal) antibody produced in mouse
Gene Information human ... RBM6(10180)	Gene Information human ... RBM6(10180)	Gene Information human ... RBM6(10180)	Gene Information human ... RBMS3(27303)
clone 4B3, monoclonal	clone 3E9, monoclonal	clone polyclonal	clone 3B11, monoclonal
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form purified immunoglobulin	antibody form purified immunoglobulin	antibody form IgG fraction of antiserum	antibody form purified immunoglobulin
biological source mouse	biological source mouse	biological source mouse	biological source mouse
species reactivity human	species reactivity human	species reactivity human	species reactivity human

General description

Mouse monoclonal antibody raised against a partial recombinant RBM6. RNA binding motif protein 6 (RBM6) is expressed in peripheral blood leukocytes, thymus and lymph nodes. The gene encoding it is localized on human chromosome 3p21.3 and has 21 exons.

Immunogen

RBM6 (NP_005768.1, 1024 a.a. ~ 1123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD

Biochem/physiol Actions

RNA binding motif protein 6 (RBM6) associates with RNA. It has been linked to lung cancers.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

08172-4B3

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

RBM5, 6, and 10 differentially regulate NUMB alternative splicing to control cancer cell proliferation.

Elias G Bechara et al.

Molecular cell, 52(5), 720-733 (2013-12-18)

RBM5, a regulator of alternative splicing of apoptotic genes, and its highly homologous RBM6 and RBM10 are RNA-binding proteins frequently deleted or mutated in lung cancer. We report that RBM5/6 and RBM10 antagonistically regulate the proliferative capacity of cancer cells

A novel fusion of RBM6 to CSF1R in acute megakaryoblastic leukemia.

Ting-lei Gu et al.

Blood, 110(1), 323-333 (2007-03-16)

Activated tyrosine kinases have been frequently implicated in the pathogenesis of cancer, including acute myeloid leukemia (AML), and are validated targets for therapeutic intervention with small-molecule kinase inhibitors. To identify novel activated tyrosine kinases in AML, we used a discovery

RBM6-RBM5 transcription-induced chimeras are differentially expressed in tumours.

Ke Wang et al.

BMC genomics, 8, 348-348 (2007-10-03)

Transcription-induced chimerism, a mechanism involving the transcription and intergenic splicing of two consecutive genes, has recently been estimated to account for approximately 5% of the human transcriptome. Despite this prevalence, the regulation and function of these fused transcripts remains largely

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service