Key Documents

View All Documentation

Anti-BLZF1 antibody produced in rabbit

Name: Anti-BLZF1 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD
Availability: InStock

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Synonym(s):

Anti-Basic leucine zipper nuclear factor 1, Anti-Golgin-45, Anti-JEM-1, Anti-p45 basic leucine-zipper nuclear factor

Select a Size

Change View

Size/SKU	Availability	Price
100 μL	Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA027331

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$667.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Segment

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:500- 1:1000

immunogen sequence

ETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVRSRKHHSLQSPWKKAVPSESPGVLQLGKMLTEKAMEVKAVRI

UniProt accession no.

Q9H2G9

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BLZF1(8548)

Description

General description

The gene BLZF1 (basic leucine zipper nuclear factor 1) is mapped to human chromosome 1q24. It belongs to the b-ZIP family of proteins. The encoded protein has a PEST (proline [P], glutamic acid [E], serine [S], and threonine [T]) motif, a putative leucine repeat and several phosphorylation sites. This protein is present in the nucleus, cytoplasm and Golgi apparatus.

Immunogen

Golgin-45 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-BLZF1 antibody produced in rabbit has been used for western blotting and immunohistochemistry.

Biochem/physiol Actions

BLZF1 (basic leucine zipper nuclear factor 1) might work as a transcription factor. It is involved in epigenetic regulation by binding to DNMT3L (DNA methyltransferase 3 like) and also participates in Wnt/β-catenin signaling. The BLZF1 gene is downregulated in acute promyelocytic leukemia (APL) cell line NB4. On the other hand, it is upregulated in presence of dengue virus infection. BLZF1 also interacts with GRASP55 (the medial-Golgi matrix protein) and the GTP form of rab2. It is involved in the secretory protein transport and maintenance of the Golgi structure. This gene is downregulated in hepatocellular carcinoma. This low expression is associated with poor overall survival.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST76645

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA067113	HPA073693	HPA001755
Sigma-Aldrich HPA027331 Anti-BLZF1 antibody produced in rabbit	Sigma-Aldrich HPA067113 Anti-BLZF1 antibody produced in rabbit	Sigma-Aldrich HPA073693 Anti-FEZF1 antibody produced in rabbit	Sigma-Aldrich HPA001755 Anti-ELF1 antibody produced in rabbit
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
Gene Information human ... BLZF1(8548)	Gene Information human ... BLZF1(8548)	Gene Information human ... FEZF1(389549)	Gene Information human ... ELF1(1997)
shipped in wet ice	shipped in wet ice	shipped in wet ice	shipped in wet ice

Still not finding the right product?

Explore all of our products under Anti-BLZF1 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c