Select a Size
| Size/SKU | Availability | Price |
|---|
About This Item
biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
purified by
(Affinity purified using the PrEST antigen as affinity ligand)
species reactivity
human
concentration
0.3mg/ml
isotype
IgG
sequence note
DEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNE
Ensembl | human accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
-10 to -25°C
target post-translational modification
unmodified
Gene Information
human ... SERPINB2(5055)
Immunogen
Application
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies™ protocols and other useful information.
Features and Benefits
Physical form
Other Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Legal Information
Disclaimer
1 of 1
This Item | |||
|---|---|---|---|
| description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution | description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution | description clone 3A9, purified immunoglobulin, buffered aqueous solution | description Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution |
| clone polyclonal | clone polyclonal | clone 3A9, monoclonal | clone polyclonal |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form purified immunoglobulin | antibody form affinity isolated antibody |
| biological source rabbit | biological source rabbit | biological source mouse | biological source rabbit |
| species reactivity human | species reactivity human | species reactivity human | species reactivity human |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| storage temp. -10 to -25°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
Still not finding the right product?
Explore all of our products under Anti-Serpinb2 Antibody Produced In Rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.



