AV13018

Anti-CHRNA7 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-Cholinergic receptor, nicotinic, α 7
• UNSPSC Code: 12352203

Eigenschaften

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: lyophilized powder
• mol wt: 56 kDa
• species reactivity: human, mouse, bovine, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_000737
• UniProt accession no.: P36544
• storage temp.: −20°C
• Gene Information: human ... CHRNA7(1139)

Beschreibung

Immunogen

The immunogen for anti-CHRNA7 antibody: synthetic peptide derected towards the N terminal of human CHRNA7

Application

Anti-CHRNA7 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

CHRNA7 is a transmembrane, oligomeric, ligand-gated nicotinic receptor which upon activation by cholinergic binding induces ion channel opening for the movement of positive ions. Nicotinic acetylcholine receptors mediate presynaptic, postsynaptic and extrasynaptic signaling. CHRNA7 has a role in the release of dopamine from striatum and prefrontal cortex in rats indicating a role in the progression of Parkinson′s disease and schizophrenia.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Other Notes

Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 12 - Non Combustible Liquids
• Was ist los?: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable