M1882
Synonym(e):
Myoglobin from horse heart
| Größe/SKU | Verfügbarkeit | Preis |
|---|---|---|
250 mg | Warenkorb auf Verfügbarkeit prüfen | € 111,00 |
1 g | Warenkorb auf Verfügbarkeit prüfen | € 356,00 |
5 g | Warenkorb auf Verfügbarkeit prüfen | € 1.420,00 |
10 g | Warenkorb auf Verfügbarkeit prüfen | € 2.470,00 |
equine heart
≥90% (SDS-PAGE)
essentially salt-free, lyophilized powder
≥0.20%
MALDI-MS: suitable
−20°C
horse ... MB(100054434)
1 of 1
Dieser Artikel | |||
|---|---|---|---|
| description ≥90% (SDS-PAGE), essentially salt-free, lyophilized powder | description 95-100%, essentially salt-free, lyophilized powder | description Isoelectric focusing marker, pI (1) 6.8, (2) 7.2 | description ≥95% (SDS-PAGE), buffered aqueous glycerol solution |
| biological source equine heart | biological source equine skeletal muscle | biological source - | biological source human heart |
| assay ≥90% (SDS-PAGE) | assay 95-100% | assay - | assay ≥95% (SDS-PAGE) |
| technique(s) MALDI-MS: suitable | technique(s) mass spectrometry (MS): suitable | technique(s) - | technique(s) - |
| form essentially salt-free, lyophilized powder | form essentially salt-free, lyophilized powder | form powder | form buffered aqueous glycerol solution |
| Gene Information horse ... MB(100054434) | Gene Information horse ... MB(100054434) | Gene Information - | Gene Information human ... MB(4151) |
| UniProt accession no. | UniProt accession no. | UniProt accession no. - | UniProt accession no. |
Explore all of our products under Myoglobin aus Pferdeherz
11 - Combustible Solids
WGK 3
Not applicable
Not applicable
Eyeshields, Gloves, type N95 (US)
Hier finden Sie alle aktuellen Versionen:
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
Do you have the sequence for Product M1882, Myoglobin from equine heart?
This product has not been specifically sequenced. However, according to the Uniprot accession number P68082, equine myoglobin has the following sequence:
MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQG
Please see the link below to review additional information available at UniProt:
Helpful?
This product is native myoglobin isolated from equine heart and is probably a mixture of oxidized myoglobin (metmyoglobin, Fe3+) and reduced myoglobin (Fe2+). The percentages of oxidized or reduced myoglobin in the product are not determined.
Helpful?
This product is native myoglobin isolated from equine heart.
Helpful?
This item has not been tested in-house for detectability and quantifiability by common laboratory tests. The specifications for this item do not include testing by these methods.
Helpful?
Is Product M1882, Myoglobin from equine heart, metmyoglobin?
The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.
Helpful?
Is Product M1882, Myoglobin from equine heart, oxidized?
Yes, it is oxidized.
Helpful?
Which has more affinity for oxygen, hemoglobin or myoglobin?
The affinity of myoglobin for oxygen is higher than that of hemoglobin.
Helpful?
What is the Department of Transportation shipping information for this product?
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
What is the molecular weight of Product M1882, Myoglobin from equine heart?
Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.
Helpful?
